Lineage for d2bvfa2 (2bvf A:206-457)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198038Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2198122Family d.58.32.5: 6-hydroxy-d-nicotine oxidase [254168] (2 proteins)
    Pfam PF08031; PubMed 16095622
  6. 2198123Protein 6-hydroxy-d-nicotine oxidase [254377] (1 species)
  7. 2198124Species Arthrobacter nicotinovorans [TaxId:29320] [254810] (2 PDB entries)
  8. 2198125Domain d2bvfa2: 2bvf A:206-457 [241340]
    Other proteins in same PDB: d2bvfa1, d2bvfb1
    automated match to d2bvha1
    complexed with fad

Details for d2bvfa2

PDB Entry: 2bvf (more details), 1.92 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 3 (p1)
PDB Compounds: (A:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvfa2 d.58.32.5 (A:206-457) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]}
prkmlagfitwapsvselaglltslldalnemadhiypsvfvgvdenrapsvtvcvghlg
gldiaerdiarlrglgrtvsdsiavrsydevvalnaevgsfedgmsnlwidreiampnar
faeaiagnldkfvsepasggsvkleiegmpfgnpkrtparhrdamgvlalaewsgaapgs
ekypelareldaallragvttsgfgllnnnsevtaemvaevykpevysrlaavkreydpe
nrfrhnynidpe

SCOPe Domain Coordinates for d2bvfa2:

Click to download the PDB-style file with coordinates for d2bvfa2.
(The format of our PDB-style files is described here.)

Timeline for d2bvfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvfa1