| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
| Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
| Protein automated matches [230549] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries) |
| Domain d2bu7a1: 2bu7 A:6-169 [241337] Other proteins in same PDB: d2bu7a2 automated match to d2bu8a1 complexed with tf3 |
PDB Entry: 2bu7 (more details), 2.4 Å
SCOPe Domain Sequences for d2bu7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bu7a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d2bu7a1: