SCOPe 2.05: Domain d2bu2a1: 2bu2 A:6-169

Lineage for d2bu2a1 (2bu2 A:6-169)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)

8. Domain d2bu2a1: 2bu2 A:6-169 [241331]
   Other proteins in same PDB: d2bu2a2
   automated match to d2bu8a1
   complexed with atp, mg, tf1

Details for d2bu2a1

PDB Entry: 2bu2, 2.4 Å

PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands

PDB Compounds: (A:) pyruvate dehydrogensae kinase isoenzyme 2

SCOPe Domain Sequences for d2bu2a1:

Sequence, based on SEQRES records:

>d2bu2a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records):

>d2bu2a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfsnacektsftflrqelpvrlanimkeinllpdrv
lstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgvl
eykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Timeline for d2bu2a1:

• d2bu2a1 first appeared in SCOPe 2.04
  
• d2bu2a1 appears in SCOPe 2.06
  
• d2bu2a1 appears in the current release, SCOPe 2.08