![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
![]() | Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
![]() | Protein automated matches [230549] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries) |
![]() | Domain d2bu2a1: 2bu2 A:6-169 [241331] Other proteins in same PDB: d2bu2a2 automated match to d2bu8a1 complexed with atp, mg, tf1 |
PDB Entry: 2bu2 (more details), 2.4 Å
SCOPe Domain Sequences for d2bu2a1:
Sequence, based on SEQRES records: (download)
>d2bu2a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
>d2bu2a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsapkyiehfskfspsplsmkqfldfsnacektsftflrqelpvrlanimkeinllpdrv lstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgvl eykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d2bu2a1: