Lineage for d1dgla_ (1dgl A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12604Species Mucana (Dioclea grandiflora) [TaxId:3837] [49916] (1 PDB entry)
  8. 12605Domain d1dgla_: 1dgl A: [24133]

Details for d1dgla_

PDB Entry: 1dgl (more details), 2.4 Å

PDB Description: lectin from dioclea grandiflora complexed to trimannoside

SCOP Domain Sequences for d1dgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgla_ b.29.1.1 (A:) Lectin {Mucana (Dioclea grandiflora)}
adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOP Domain Coordinates for d1dgla_:

Click to download the PDB-style file with coordinates for d1dgla_.
(The format of our PDB-style files is described here.)

Timeline for d1dgla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dglb_