SCOPe 2.08: Domain d1dgla_: 1dgl A:

Lineage for d1dgla_ (1dgl A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Mucana (Dioclea grandiflora) [TaxId:3837] [49916] (1 PDB entry)
   natural circle permutation resulting from a post-translational modification of precursor

8. Domain d1dgla_: 1dgl A: [24133]
   complexed with ca, mn

Details for d1dgla_

PDB Entry: 1dgl, 2.4 Å

PDB Description: lectin from dioclea grandiflora complexed to trimannoside

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1dgla_:

Sequence; same for both SEQRES and ATOM records:

>d1dgla_ b.29.1.1 (A:) Legume lectin {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Timeline for d1dgla_:

• d1dgla_ first appeared (with stable ids) in SCOP 1.55
  
• d1dgla_ appears in SCOPe 2.07