Lineage for d1dgla_ (1dgl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042524Species Mucana (Dioclea grandiflora) [TaxId:3837] [49916] (1 PDB entry)
    natural circle permutation resulting from a post-translational modification of precursor
  8. 2042525Domain d1dgla_: 1dgl A: [24133]
    complexed with ca, mn

Details for d1dgla_

PDB Entry: 1dgl (more details), 2.4 Å

PDB Description: lectin from dioclea grandiflora complexed to trimannoside
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1dgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgla_ b.29.1.1 (A:) Legume lectin {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d1dgla_:

Click to download the PDB-style file with coordinates for d1dgla_.
(The format of our PDB-style files is described here.)

Timeline for d1dgla_: