SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2btza1 (2btz A:6-169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993195Protein automated matches [230549] (2 species)
    not a true protein
  7. 1993196Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)
  8. 1993203Domain d2btza1: 2btz A:6-169 [241329]
    Other proteins in same PDB: d2btza2
    automated match to d2bu8a1

Details for d2btza1

PDB Entry: 2btz (more details), 2.2 Å

PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands
PDB Compounds: (A:) pyruvate dehydrogenase kinase isoenzyme 2

SCOPe Domain Sequences for d2btza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btza1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d2btza1:

Click to download the PDB-style file with coordinates for d2btza1.
(The format of our PDB-style files is described here.)

Timeline for d2btza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2btza2