Lineage for d2btza1 (2btz A:6-169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993195Protein automated matches [230549] (2 species)
    not a true protein
  7. 1993196Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)
  8. 1993203Domain d2btza1: 2btz A:6-169 [241329]
    Other proteins in same PDB: d2btza2
    automated match to d2bu8a1

Details for d2btza1

PDB Entry: 2btz (more details), 2.2 Å

PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands
PDB Compounds: (A:) pyruvate dehydrogenase kinase isoenzyme 2

SCOPe Domain Sequences for d2btza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btza1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d2btza1:

Click to download the PDB-style file with coordinates for d2btza1.
(The format of our PDB-style files is described here.)

Timeline for d2btza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2btza2