Lineage for d2btga_ (2btg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986630Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986631Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1986632Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. 1986650Protein automated matches [254439] (2 species)
    not a true protein
  7. 1986655Species Escherichia coli [TaxId:562] [254934] (5 PDB entries)
  8. 1986657Domain d2btga_: 2btg A: [241326]
    automated match to d1bala_

Details for d2btga_

PDB Entry: 2btg (more details)

PDB Description: peripheral-subunit binding domains from mesophilic,thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
PDB Compounds: (A:) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex

SCOPe Domain Sequences for d2btga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btga_ a.9.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qnndalspairrllaehnldasaikgtgvggrltredvekwlaka

SCOPe Domain Coordinates for d2btga_:

Click to download the PDB-style file with coordinates for d2btga_.
(The format of our PDB-style files is described here.)

Timeline for d2btga_: