SCOPe 2.08: Domain d2btga_: 2btg A:

Lineage for d2btga_ (2btg A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)

6. Protein automated matches [254439] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254934] (5 PDB entries)

8. Domain d2btga_: 2btg A: [241326]
   automated match to d1bala_

Details for d2btga_

PDB Entry: 2btg

PDB Description: peripheral-subunit binding domains from mesophilic,thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions

PDB Compounds: (A:) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex

SCOPe Domain Sequences for d2btga_:

Sequence; same for both SEQRES and ATOM records:

>d2btga_ a.9.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qnndalspairrllaehnldasaikgtgvggrltredvekwlaka

Timeline for d2btga_:

• d2btga_ first appeared in SCOPe 2.04
  
• d2btga_ appears in SCOPe 2.07