Lineage for d2br7e_ (2br7 E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (4 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries)
  8. 2408791Domain d2br7e_: 2br7 E: [241324]
    automated match to d2c9ta_
    complexed with epe

Details for d2br7e_

PDB Entry: 2br7 (more details), 3 Å

PDB Description: crystal structure of acetylcholine-binding protein (achbp) from aplysia californica in complex with hepes
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2br7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br7e_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2br7e_:

Click to download the PDB-style file with coordinates for d2br7e_.
(The format of our PDB-style files is described here.)

Timeline for d2br7e_: