SCOPe 2.04: Domain d2br7d_: 2br7 D:

Lineage for d2br7d_ (2br7 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (4 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries)

8. Domain d2br7d_: 2br7 D: [241323]
   automated match to d2c9ta_
   complexed with epe

Details for d2br7d_

PDB Entry: 2br7, 3 Å

PDB Description: crystal structure of acetylcholine-binding protein (achbp) from aplysia californica in complex with hepes

PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2br7d_:

Sequence; same for both SEQRES and ATOM records:

>d2br7d_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

Timeline for d2br7d_:

• d2br7d_ is new in SCOPe 2.04-stable
  
• d2br7d_ appears in SCOPe 2.05
  
• d2br7d_ appears in the current release, SCOPe 2.08