Lineage for d1lulf_ (1lul F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2373210Protein Legume lectin [49904] (23 species)
  7. 2373315Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2373338Domain d1lulf_: 1lul F: [24132]
    Db58
    complexed with ca, mn

Details for d1lulf_

PDB Entry: 1lul (more details), 3.3 Å

PDB Description: db58, a legume lectin from dolichos biflorus
PDB Compounds: (F:) lectin db58

SCOPe Domain Sequences for d1lulf_:

Sequence, based on SEQRES records: (download)

>d1lulf_ b.29.1.1 (F:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1lulf_ b.29.1.1 (F:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd

SCOPe Domain Coordinates for d1lulf_:

Click to download the PDB-style file with coordinates for d1lulf_.
(The format of our PDB-style files is described here.)

Timeline for d1lulf_: