Lineage for d2bp1d_ (2bp1 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568369Protein automated matches [190169] (5 species)
    not a true protein
  7. 1568370Species Human (Homo sapiens) [TaxId:9606] [188399] (48 PDB entries)
  8. 1568429Domain d2bp1d_: 2bp1 D: [241319]
    automated match to d2c91a_
    complexed with flc, ndp

Details for d2bp1d_

PDB Entry: 2bp1 (more details), 2.4 Å

PDB Description: structure of the aflatoxin aldehyde reductase in complex with nadph
PDB Compounds: (D:) aflatoxin b1 aldehyde reductase member 2

SCOPe Domain Sequences for d2bp1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp1d_ c.1.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvasvlgtmemgrrmdapasaaavraflerghteldtafmysdgqsetilgglglglggg
dcrvkiatkanpwdgkslkpdsvrsqletslkrlqcpqvdlfylhapdhgtpveetlhac
qrlhqegkfvelglsnyaswevaeictlcksngwilptvyqgmynattrqvetelfpclr
hfglrfyaynplagglltgkykyedkdgkqpvgrffgnswaetyrnrfwkehhfeaialv
ekalqaaygasapsvtsaalrwmyhhsqlqgahgdavilgmssleqleqnlaateegple
pavvdafnqawhlvahecpnyfr

SCOPe Domain Coordinates for d2bp1d_:

Click to download the PDB-style file with coordinates for d2bp1d_.
(The format of our PDB-style files is described here.)

Timeline for d2bp1d_: