![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
![]() | Protein automated matches [190495] (3 species) not a true protein |
![]() | Species Bacteriophage MS2 [TaxId:12022] [187484] (2 PDB entries) |
![]() | Domain d2bnyc_: 2bny C: [241315] automated match to d2bs1a_ protein/RNA complex; mutant |
PDB Entry: 2bny (more details), 3 Å
SCOPe Domain Sequences for d2bnyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnyc_ d.85.1.1 (C:) automated matches {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylameltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d2bnyc_: