Lineage for d2bnyb_ (2bny B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659798Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1659799Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1659800Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1659942Protein automated matches [190495] (3 species)
    not a true protein
  7. 1659943Species Bacteriophage MS2 [TaxId:12022] [187484] (2 PDB entries)
  8. 1659945Domain d2bnyb_: 2bny B: [241314]
    automated match to d2bs1a_
    protein/RNA complex; mutant

Details for d2bnyb_

PDB Entry: 2bny (more details), 3 Å

PDB Description: ms2 (n87a mutant) - rna hairpin complex
PDB Compounds: (B:) ms2 coat protein

SCOPe Domain Sequences for d2bnyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnyb_ d.85.1.1 (B:) automated matches {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylameltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2bnyb_:

Click to download the PDB-style file with coordinates for d2bnyb_.
(The format of our PDB-style files is described here.)

Timeline for d2bnyb_: