Lineage for d2bnya_ (2bny A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569071Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2569072Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2569073Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2569238Protein automated matches [190495] (3 species)
    not a true protein
  7. 2569239Species Bacteriophage MS2 [TaxId:12022] [187484] (2 PDB entries)
  8. 2569240Domain d2bnya_: 2bny A: [241313]
    automated match to d2bs1a_
    protein/RNA complex; mutant

Details for d2bnya_

PDB Entry: 2bny (more details), 3 Å

PDB Description: ms2 (n87a mutant) - rna hairpin complex
PDB Compounds: (A:) ms2 coat protein

SCOPe Domain Sequences for d2bnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnya_ d.85.1.1 (A:) automated matches {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylameltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2bnya_:

Click to download the PDB-style file with coordinates for d2bnya_.
(The format of our PDB-style files is described here.)

Timeline for d2bnya_: