Lineage for d2bgsa_ (2bgs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081401Species Barley (Hordeum vulgare) [TaxId:4513] [255051] (3 PDB entries)
  8. 2081402Domain d2bgsa_: 2bgs A: [241311]
    automated match to d3h7ua_
    complexed with bct, ndp, so4

Details for d2bgsa_

PDB Entry: 2bgs (more details), 1.64 Å

PDB Description: holo aldose reductase from barley
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d2bgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgsa_ c.1.7.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
qdhfvlksghampavglgtwragsdtahsvrtaiteagyrhvdtaaeygvekevgkglka
ameagidrkdlfvtskiwctnlapervrpalentlkdlqldyidlyhihwpfrlkdgahm
ppeagevlefdmegvwkemenlvkdglvkdigvcnytvtklnrllrsakippavcqmemh
pgwkndkifeackkhgihitaysplgsseknlahdpvvekvanklnktpgqvlikwalqr
gtsvipksskderikeniqvfgweipeedfkvlcsikdekrvltgeelfvnkthgpyrsa
rdvwdhen

SCOPe Domain Coordinates for d2bgsa_:

Click to download the PDB-style file with coordinates for d2bgsa_.
(The format of our PDB-style files is described here.)

Timeline for d2bgsa_: