Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225832] (2 PDB entries) |
Domain d2bdwa_: 2bdw A: [241308] automated match to d2wela_ |
PDB Entry: 2bdw (more details), 1.8 Å
SCOPe Domain Sequences for d2bdwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdwa_ d.144.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} stkfsdnydvkeelgkgafsvvrrcvhkttglefaakiintkklsardfqklerearicr klqhpnivrlhdsiqeesfhylvfdlvtggelfedivarefyseadashciqqilesiay chsngivhrnlkpenlllaskakgaavkladfglaievndseawhgfagtpgylspevlk kdpyskpvdiwacgvilyillvgyppfwdedqhrlyaqikagaydypspewdtvtpeaks lidsmltvnpkkritadqalkvpwicnrervasaihrqdtvdclkkfnarrklkgailtt miatrnlsn
Timeline for d2bdwa_: