SCOPe 2.05: Domain d2bdwa_: 2bdw A:

Lineage for d2bdwa_ (2bdw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (21 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225832] (2 PDB entries)

8. Domain d2bdwa_: 2bdw A: [241308]
   automated match to d2wela_

Details for d2bdwa_

PDB Entry: 2bdw, 1.8 Å

PDB Description: crystal structure of the auto-inhibited kinase domain of calcium/calmodulin activated kinase ii

PDB Compounds: (A:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2bdwa_:

Sequence; same for both SEQRES and ATOM records:

>d2bdwa_ d.144.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
stkfsdnydvkeelgkgafsvvrrcvhkttglefaakiintkklsardfqklerearicr
klqhpnivrlhdsiqeesfhylvfdlvtggelfedivarefyseadashciqqilesiay
chsngivhrnlkpenlllaskakgaavkladfglaievndseawhgfagtpgylspevlk
kdpyskpvdiwacgvilyillvgyppfwdedqhrlyaqikagaydypspewdtvtpeaks
lidsmltvnpkkritadqalkvpwicnrervasaihrqdtvdclkkfnarrklkgailtt
miatrnlsn

Timeline for d2bdwa_:

• d2bdwa_ first appeared in SCOPe 2.04
  
• d2bdwa_ appears in SCOPe 2.06
  
• d2bdwa_ appears in the current release, SCOPe 2.08