Lineage for d1luld_ (1lul D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57719Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 57740Domain d1luld_: 1lul D: [24130]

Details for d1luld_

PDB Entry: 1lul (more details), 3.3 Å

PDB Description: db58, a legume lectin from dolichos biflorus

SCOP Domain Sequences for d1luld_:

Sequence, based on SEQRES records: (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd

SCOP Domain Coordinates for d1luld_:

Click to download the PDB-style file with coordinates for d1luld_.
(The format of our PDB-style files is described here.)

Timeline for d1luld_: