Lineage for d1luld_ (1lul D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042469Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2042490Domain d1luld_: 1lul D: [24130]
    Db58
    complexed with ca, mn

Details for d1luld_

PDB Entry: 1lul (more details), 3.3 Å

PDB Description: db58, a legume lectin from dolichos biflorus
PDB Compounds: (D:) lectin db58

SCOPe Domain Sequences for d1luld_:

Sequence, based on SEQRES records: (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd

SCOPe Domain Coordinates for d1luld_:

Click to download the PDB-style file with coordinates for d1luld_.
(The format of our PDB-style files is described here.)

Timeline for d1luld_: