SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1luld_ (1lul D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042469Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2042490Domain d1luld_: 1lul D: [24130]
    Db58
    complexed with ca, mn

Details for d1luld_

PDB Entry: 1lul (more details), 3.3 Å

PDB Description: db58, a legume lectin from dolichos biflorus
PDB Compounds: (D:) lectin db58

SCOPe Domain Sequences for d1luld_:

Sequence, based on SEQRES records: (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1luld_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd

SCOPe Domain Coordinates for d1luld_:

Click to download the PDB-style file with coordinates for d1luld_.
(The format of our PDB-style files is described here.)

Timeline for d1luld_: