Lineage for d2bdih_ (2bdi H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547699Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1547700Protein automated matches [190438] (19 species)
    not a true protein
  7. 1547722Species Human (Homo sapiens) [TaxId:9606] [187421] (42 PDB entries)
  8. 1547782Domain d2bdih_: 2bdi H: [241299]
    automated match to d2bdga_
    complexed with co, pbz

Details for d2bdih_

PDB Entry: 2bdi (more details), 3 Å

PDB Description: Human Kallikrein 4 complex with cobalt and p-aminobenzamidine
PDB Compounds: (H:) Kallikrein-4

SCOPe Domain Sequences for d2bdih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdih_ b.47.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

SCOPe Domain Coordinates for d2bdih_:

Click to download the PDB-style file with coordinates for d2bdih_.
(The format of our PDB-style files is described here.)

Timeline for d2bdih_: