Lineage for d2bdha_ (2bdh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798248Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. 2798391Domain d2bdha_: 2bdh A: [241288]
    automated match to d2bdga_
    complexed with pbz, zn

Details for d2bdha_

PDB Entry: 2bdh (more details), 3 Å

PDB Description: Human Kallikrein 4 complex with zinc and p-aminobenzamidine
PDB Compounds: (A:) Kallikrein-4

SCOPe Domain Sequences for d2bdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdha_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

SCOPe Domain Coordinates for d2bdha_:

Click to download the PDB-style file with coordinates for d2bdha_.
(The format of our PDB-style files is described here.)

Timeline for d2bdha_: