Lineage for d2b88a_ (2b88 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2697064Protein automated matches [191290] (5 species)
    not a true protein
  7. 2697072Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries)
  8. 2697097Domain d2b88a_: 2b88 A: [241284]
    automated match to d1h0ta_

Details for d2b88a_

PDB Entry: 2b88 (more details)

PDB Description: structural basis for molecular recognition in an affibody:affibody complex
PDB Compounds: (A:) ZTaq affibody

SCOPe Domain Sequences for d2b88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b88a_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
vdnkfnkelgwatweifnlpnlngvqvkafidslrddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d2b88a_:

Click to download the PDB-style file with coordinates for d2b88a_.
(The format of our PDB-style files is described here.)

Timeline for d2b88a_: