| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Nck-2 [159019] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [159020] (2 PDB entries) Uniprot O43639 192-262 unclassified SH3 domains of this protein species are: 1WX6, 2B86, 2FRW, 2FRY |
| Domain d2b86a_: 2b86 A: [241281] automated match to d5hcka_ |
PDB Entry: 2b86 (more details)
SCOPe Domain Sequences for d2b86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b86a_ b.34.2.1 (A:) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}
mteeviviakwdytaqqdqeldikknerlwllddsktwwrvrnaanrtgyvpsnyverk
Timeline for d2b86a_: