Lineage for d2b86a_ (2b86 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536376Protein Nck-2 [159019] (1 species)
  7. 1536377Species Human (Homo sapiens) [TaxId:9606] [159020] (2 PDB entries)
    Uniprot O43639 192-262
    unclassified SH3 domains of this protein species are: 1WX6, 2B86, 2FRW, 2FRY
  8. 1536378Domain d2b86a_: 2b86 A: [241281]
    automated match to d5hcka_

Details for d2b86a_

PDB Entry: 2b86 (more details)

PDB Description: solution structure of the first src homology 3 domain of nck2
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d2b86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b86a_ b.34.2.1 (A:) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}
mteeviviakwdytaqqdqeldikknerlwllddsktwwrvrnaanrtgyvpsnyverk

SCOPe Domain Coordinates for d2b86a_:

Click to download the PDB-style file with coordinates for d2b86a_.
(The format of our PDB-style files is described here.)

Timeline for d2b86a_: