Lineage for d1lulb_ (1lul B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371353Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 371372Domain d1lulb_: 1lul B: [24128]

Details for d1lulb_

PDB Entry: 1lul (more details), 3.3 Å

PDB Description: db58, a legume lectin from dolichos biflorus

SCOP Domain Sequences for d1lulb_:

Sequence, based on SEQRES records: (download)

>d1lulb_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
pldiasylvrnvl

Sequence, based on observed residues (ATOM records): (download)

>d1lulb_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpddsttepldiasy
lvrnvl

SCOP Domain Coordinates for d1lulb_:

Click to download the PDB-style file with coordinates for d1lulb_.
(The format of our PDB-style files is described here.)

Timeline for d1lulb_: