Lineage for d2b7ld_ (2b7l D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442754Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
    automatically mapped to Pfam PF01467
  6. 2442763Protein automated matches [254481] (1 species)
    not a true protein
  7. 2442764Species Staphylococcus aureus [TaxId:1280] [255045] (1 PDB entry)
  8. 2442768Domain d2b7ld_: 2b7l D: [241276]
    automated match to d1coza_

Details for d2b7ld_

PDB Entry: 2b7l (more details), 3 Å

PDB Description: Crystal Structure of CTP:Glycerol-3-Phosphate Cytidylyltransferase from Staphylococcus aureus
PDB Compounds: (D:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2b7ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ld_ c.26.1.2 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkrvitygtydllhyghiellrraremgdylivalstdefnqikhkksyydyeqrkmmle
siryvdlvipekgwgqkeddvekfdvdvfvmghdwegefdflkdkceviylkr

SCOPe Domain Coordinates for d2b7ld_:

Click to download the PDB-style file with coordinates for d2b7ld_.
(The format of our PDB-style files is described here.)

Timeline for d2b7ld_: