Lineage for d2b7lb_ (2b7l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860358Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
    automatically mapped to Pfam PF01467
  6. 2860367Protein automated matches [254481] (1 species)
    not a true protein
  7. 2860368Species Staphylococcus aureus [TaxId:1280] [255045] (1 PDB entry)
  8. 2860370Domain d2b7lb_: 2b7l B: [241274]
    automated match to d1coza_

Details for d2b7lb_

PDB Entry: 2b7l (more details), 3 Å

PDB Description: Crystal Structure of CTP:Glycerol-3-Phosphate Cytidylyltransferase from Staphylococcus aureus
PDB Compounds: (B:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2b7lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7lb_ c.26.1.2 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkrvitygtydllhyghiellrraremgdylivalstdefnqikhkksyydyeqrkmmle
siryvdlvipekgwgqkeddvekfdvdvfvmghdwegefdflkdkceviylkr

SCOPe Domain Coordinates for d2b7lb_:

Click to download the PDB-style file with coordinates for d2b7lb_.
(The format of our PDB-style files is described here.)

Timeline for d2b7lb_: