Lineage for d2b5ma3 (2b5m A:1044-1140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739334Fold a.297: DDB1 C-terminal-like [254113] (1 superfamily)
    5 helices in an irregular bundle. Slight similarity to SAM domains (a.60)
  4. 2739335Superfamily a.297.1: DDB1 C-terminal-like [254135] (1 family) (S)
    PubMed 16413485; part of Pfam PF03178.
  5. 2739336Family a.297.1.1: DDB1 C-terminal-like [254177] (1 protein)
  6. 2739337Protein DDB1 C-terminal domain [254397] (1 species)
  7. 2739338Species Human (Homo sapiens) [TaxId:9606] [254833] (2 PDB entries)
  8. 2739341Domain d2b5ma3: 2b5m A:1044-1140 [241271]
    Other proteins in same PDB: d2b5ma1, d2b5ma2, d2b5ma4
    protein/DNA complex

Details for d2b5ma3

PDB Entry: 2b5m (more details), 2.92 Å

PDB Description: Crystal Structure of DDB1
PDB Compounds: (A:) damage-specific DNA binding protein 1

SCOPe Domain Sequences for d2b5ma3:

Sequence, based on SEQRES records: (download)

>d2b5ma3 a.297.1.1 (A:1044-1140) DDB1 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
seswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgfidgdliesfldisrp
kmqevvanlqyddgsgmkreataddlikvveeltrih

Sequence, based on observed residues (ATOM records): (download)

>d2b5ma3 a.297.1.1 (A:1044-1140) DDB1 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
seswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgfidgdliesfldisrp
kmqevvanlreataddlikvveeltrih

SCOPe Domain Coordinates for d2b5ma3:

Click to download the PDB-style file with coordinates for d2b5ma3.
(The format of our PDB-style files is described here.)

Timeline for d2b5ma3: