Lineage for d2b5ma1 (2b5m A:14-354)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066110Family b.69.4.3: DDB1-like [254176] (1 protein)
    PubMed 16413485; combines Pfam PF10433 and Pfam PF03178. Distant homology to WD40 proposed in PubMed 10982878
  6. 2066111Protein DDB1 [254396] (1 species)
  7. 2066112Species Human (Homo sapiens) [TaxId:9606] [254832] (2 PDB entries)
  8. 2066119Domain d2b5ma1: 2b5m A:14-354 [241269]
    Other proteins in same PDB: d2b5ma3
    protein/DNA complex

Details for d2b5ma1

PDB Entry: 2b5m (more details), 2.92 Å

PDB Description: Crystal Structure of DDB1
PDB Compounds: (A:) damage-specific DNA binding protein 1

SCOPe Domain Sequences for d2b5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ma1 b.69.4.3 (A:14-354) DDB1 {Human (Homo sapiens) [TaxId: 9606]}
avngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygkiavmelfrpkges
kdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgiigiidpecrmigl
rlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticfvyqdpqgrhvkty
evslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityhngdkylaiappii
kqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdlrvellgetsiaec
ltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametft

SCOPe Domain Coordinates for d2b5ma1:

Click to download the PDB-style file with coordinates for d2b5ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ma1: