Lineage for d2b5lb3 (2b5l B:1044-1140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739334Fold a.297: DDB1 C-terminal-like [254113] (1 superfamily)
    5 helices in an irregular bundle. Slight similarity to SAM domains (a.60)
  4. 2739335Superfamily a.297.1: DDB1 C-terminal-like [254135] (1 family) (S)
    PubMed 16413485; part of Pfam PF03178.
  5. 2739336Family a.297.1.1: DDB1 C-terminal-like [254177] (1 protein)
  6. 2739337Protein DDB1 C-terminal domain [254397] (1 species)
  7. 2739338Species Human (Homo sapiens) [TaxId:9606] [254833] (2 PDB entries)
  8. 2739340Domain d2b5lb3: 2b5l B:1044-1140 [241265]
    Other proteins in same PDB: d2b5la1, d2b5la2, d2b5la4, d2b5lb1, d2b5lb2, d2b5lb4, d2b5lc_, d2b5ld_
    complexed with zn

Details for d2b5lb3

PDB Entry: 2b5l (more details), 2.85 Å

PDB Description: Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
PDB Compounds: (B:) damage-specific DNA binding protein 1

SCOPe Domain Sequences for d2b5lb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5lb3 a.297.1.1 (B:1044-1140) DDB1 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
seswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgfidgdliesfldisrp
kmqevvanlqyddgsgmkreataddlikvveeltrih

SCOPe Domain Coordinates for d2b5lb3:

Click to download the PDB-style file with coordinates for d2b5lb3.
(The format of our PDB-style files is described here.)

Timeline for d2b5lb3: