Lineage for d2b5la2 (2b5l A:1-13,A:355-392,A:708-1043)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066110Family b.69.4.3: DDB1-like [254176] (1 protein)
    PubMed 16413485; combines Pfam PF10433 and Pfam PF03178. Distant homology to WD40 proposed in PubMed 10982878
  6. 2066111Protein DDB1 [254396] (1 species)
  7. 2066112Species Human (Homo sapiens) [TaxId:9606] [254832] (2 PDB entries)
  8. 2066114Domain d2b5la2: 2b5l A:1-13,A:355-392,A:708-1043 [241260]
    Other proteins in same PDB: d2b5la3, d2b5lb3, d2b5lc_, d2b5ld_
    complexed with zn

Details for d2b5la2

PDB Entry: 2b5l (more details), 2.85 Å

PDB Description: Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
PDB Compounds: (A:) damage-specific DNA binding protein 1

SCOPe Domain Sequences for d2b5la2:

Sequence, based on SEQRES records: (download)

>d2b5la2 b.69.4.3 (A:1-13,A:355-392,A:708-1043) DDB1 {Human (Homo sapiens) [TaxId: 9606]}
msynyvvtaqkptXnlgpivdmcvvdlerqgqgqlvtcsgafkegslriirnXqklhirt
vplyesprkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsss
taphetsfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgta
mvypeeaepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewt
tekdvrtecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwm
saveildddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvm
qnlgetstptqgsvlfgtvngmiglvtsl

Sequence, based on observed residues (ATOM records): (download)

>d2b5la2 b.69.4.3 (A:1-13,A:355-392,A:708-1043) DDB1 {Human (Homo sapiens) [TaxId: 9606]}
msynyvvtaqkptXnlgpivdmcvvdlerqgqgqlvtcsgafkegslriirnXqklhirt
vplyesprkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsst
sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlgst
ptqgsvlfgtvngmiglvtsl

SCOPe Domain Coordinates for d2b5la2:

Click to download the PDB-style file with coordinates for d2b5la2.
(The format of our PDB-style files is described here.)

Timeline for d2b5la2: