Lineage for d1lu2b_ (1lu2 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2049903Protein Legume lectin [49904] (23 species)
  7. 2050008Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2050017Domain d1lu2b_: 1lu2 B: [24126]
    complexed with a2g, ca, mn

Details for d1lu2b_

PDB Entry: 1lu2 (more details), 2.8 Å

PDB Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1lu2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu2b_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOPe Domain Coordinates for d1lu2b_:

Click to download the PDB-style file with coordinates for d1lu2b_.
(The format of our PDB-style files is described here.)

Timeline for d1lu2b_: