SCOP 1.63: Domain d1lu2b_: 1lu2 B:

Lineage for d1lu2b_ (1lu2 B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (22 species)

7. Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)

8. Domain d1lu2b_: 1lu2 B: [24126]
   complexed with ca, mn, nga

Details for d1lu2b_

PDB Entry: 1lu2, 2.8 Å

PDB Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide

SCOP Domain Sequences for d1lu2b_:

Sequence; same for both SEQRES and ATOM records:

>d1lu2b_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

Timeline for d1lu2b_:

• d1lu2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1lu2b_ appears in SCOP 1.61
  
• d1lu2b_ appears in SCOP 1.65
  
• d1lu2b_ appears in the current release, SCOPe 2.08