Lineage for d1lu2b_ (1lu2 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries) 
Domain d1lu2b_: 1lu2 B: [24126]
Details for d1lu2b_
PDB Entry: 1lu2 (more details), 2.8 Å
PDB Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide
SCOP Domain Sequences for d1lu2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lu2b_ b.29.1.1 (B:) Lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl
SCOP Domain Coordinates for d1lu2b_:
Click to download the PDB-style file with coordinates for d1lu2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lu2b_:
- d1lu2b_ appears in SCOP 1.57
- d1lu2b_ appears in the current release, SCOPe 2.08
View in 3D
