Lineage for d2b2ea_ (2b2e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962611Protein automated matches [190495] (3 species)
    not a true protein
  7. 2962619Species Enterobacteria phage [TaxId:12022] [187438] (2 PDB entries)
  8. 2962620Domain d2b2ea_: 2b2e A: [241250]
    automated match to d2b2da_
    protein/RNA complex; mutant

Details for d2b2ea_

PDB Entry: 2b2e (more details), 3.15 Å

PDB Description: rna stemloop from bacteriophage ms2 complexed with an n87s,e89k mutant ms2 capsid
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2b2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2ea_ d.85.1.1 (A:) automated matches {Enterobacteria phage [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2b2ea_:

Click to download the PDB-style file with coordinates for d2b2ea_.
(The format of our PDB-style files is described here.)

Timeline for d2b2ea_: