SCOPe 2.06: Domain d1lu2a_: 1lu2 A:

Lineage for d1lu2a_ (1lu2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)

8. Domain d1lu2a_: 1lu2 A: [24125]
   complexed with a2g, ca, mn

Details for d1lu2a_

PDB Entry: 1lu2, 2.8 Å

PDB Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1lu2a_:

Sequence; same for both SEQRES and ATOM records:

>d1lu2a_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

Timeline for d1lu2a_:

• d1lu2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1lu2a_ appears in SCOPe 2.05
  
• d1lu2a_ appears in SCOPe 2.07
  
• d1lu2a_ appears in the current release, SCOPe 2.08