Lineage for d1lu2a_ (1lu2 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042469Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2042477Domain d1lu2a_: 1lu2 A: [24125]
    complexed with a2g, ca, mn

Details for d1lu2a_

PDB Entry: 1lu2 (more details), 2.8 Å

PDB Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1lu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu2a_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOPe Domain Coordinates for d1lu2a_:

Click to download the PDB-style file with coordinates for d1lu2a_.
(The format of our PDB-style files is described here.)

Timeline for d1lu2a_: