Lineage for d2b1ka_ (2b1k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878156Species Escherichia coli [TaxId:562] [187437] (4 PDB entries)
  8. 2878157Domain d2b1ka_: 2b1k A: [241248]
    automated match to d1z5ye1

Details for d2b1ka_

PDB Entry: 2b1k (more details), 1.9 Å

PDB Description: Crystal structure of E. coli CcmG protein
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbE

SCOPe Domain Sequences for d2b1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ka_ c.47.1.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
lesaligkpvpkfrlesldnpgqfyqadvltqgkpvllnvwatwcptcraehqylnqlsa
qgirvvgmnykddrqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngii
ryrhagdlnprvweeeikplwekyskeaa

SCOPe Domain Coordinates for d2b1ka_:

Click to download the PDB-style file with coordinates for d2b1ka_.
(The format of our PDB-style files is described here.)

Timeline for d2b1ka_: