SCOPe 2.06: Domain d2azva_: 2azv A:

Lineage for d2azva_ (2azv A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255023] (4 PDB entries)

8. Domain d2azva_: 2azv A: [241245]
   automated match to d1gbra_
   mutant

Details for d2azva_

PDB Entry: 2azv

PDB Description: solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)

PDB Compounds: (A:) SH2-SH3 adapter protein drk

SCOPe Domain Sequences for d2azva_:

Sequence; same for both SEQRES and ATOM records:

>d2azva_ b.34.2.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meaiakhdfsataddelsfrkgqilkilnmeddsnwyraeldgkeglipsnyiemknhd

Timeline for d2azva_:

• d2azva_ first appeared in SCOPe 2.04
  
• d2azva_ appears in SCOPe 2.05
  
• d2azva_ appears in SCOPe 2.07
  
• d2azva_ appears in the current release, SCOPe 2.08