Lineage for d2azsa_ (2azs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783277Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255023] (4 PDB entries)
  8. 2783281Domain d2azsa_: 2azs A: [241244]
    automated match to d1gbra_

Details for d2azsa_

PDB Entry: 2azs (more details)

PDB Description: nmr structure of the n-terminal sh3 domain of drk (calculated without noe restraints)
PDB Compounds: (A:) SH2-SH3 adapter protein drk

SCOPe Domain Sequences for d2azsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azsa_ b.34.2.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meaiakhdfsataddelsfrktqilkilnmeddsnwyraeldgkeglipsnyiemknhd

SCOPe Domain Coordinates for d2azsa_:

Click to download the PDB-style file with coordinates for d2azsa_.
(The format of our PDB-style files is described here.)

Timeline for d2azsa_: