Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
Protein NifU [117910] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117911] (2 PDB entries) Uniprot O32163 |
Domain d2azha_: 2azh A: [241243] automated match to d1xjsa_ complexed with zn |
PDB Entry: 2azh (more details)
SCOPe Domain Sequences for d2azha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azha_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]} msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs kfparikcatlswkalekgvakeeggn
Timeline for d2azha_: