SCOPe 2.05: Domain d2apna_: 2apn A:

Lineage for d2apna_ (2apn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.124: HesB-like domain [89359] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.124.1: HesB-like domain [89360] (2 families)

5. Family b.124.1.0: automated matches [227171] (1 protein)
   not a true family

6. Protein automated matches [226886] (3 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [255035] (1 PDB entry)

8. Domain d2apna_: 2apn A: [241240]
   automated match to d1r94a_

Details for d2apna_

PDB Entry: 2apn

PDB Description: hi1723 solution structure

PDB Compounds: (A:) Protein HI1723

SCOPe Domain Sequences for d2apna_:

Sequence; same for both SEQRES and ATOM records:

>d2apna_ b.124.1.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
middmavpltftdaaankvksliseeentdlklrvyitgggcsgfqygftfdekvndgdl
tieksgvqlvidpmslqyliggtvdyteglegsrftvnnpnatstcgcgssfsi

Timeline for d2apna_:

• d2apna_ first appeared in SCOPe 2.04
  
• d2apna_ appears in SCOPe 2.06
  
• d2apna_ appears in the current release, SCOPe 2.08