Lineage for d1bjqh_ (1bjq H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164683Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 164698Domain d1bjqh_: 1bjq H: [24124]

Details for d1bjqh_

PDB Entry: 1bjq (more details), 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine

SCOP Domain Sequences for d1bjqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjqh_ b.29.1.1 (H:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOP Domain Coordinates for d1bjqh_:

Click to download the PDB-style file with coordinates for d1bjqh_.
(The format of our PDB-style files is described here.)

Timeline for d1bjqh_: