Lineage for d1bjqh_ (1bjq H:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries) 
Domain d1bjqh_: 1bjq H: [24124]
Details for d1bjqh_
PDB Entry: 1bjq (more details), 2.65 Å
PDB Description: the dolichos biflorus seed lectin in complex with adenine
SCOP Domain Sequences for d1bjqh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjqh_ b.29.1.1 (H:) Lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl
SCOP Domain Coordinates for d1bjqh_:
Click to download the PDB-style file with coordinates for d1bjqh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjqh_:
- d1bjqh_ appears in SCOP 1.57
- d1bjqh_ appears in the current release, SCOPe 2.08
View in 3D
