Lineage for d2anra2 (2anr A:106-178)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648659Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 1648660Protein automated matches [226866] (4 species)
    not a true protein
  7. 1648661Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries)
  8. 1648666Domain d2anra2: 2anr A:106-178 [241239]
    automated match to d1dtjd_
    protein/RNA complex; complexed with k, mg

Details for d2anra2

PDB Entry: 2anr (more details), 1.94 Å

PDB Description: crystal structure (ii) of nova-1 kh1/kh2 domain tandem with 25nt rna hairpin
PDB Compounds: (A:) neuro-oncological ventral antigen 1

SCOPe Domain Sequences for d2anra2:

Sequence, based on SEQRES records: (download)

>d2anra2 d.51.1.0 (A:106-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkiivpnstagliigkggatvkaimeqsgawvqlsqkpdginlqnrvvtvsgepeqnrka
veliiqkiqedpq

Sequence, based on observed residues (ATOM records): (download)

>d2anra2 d.51.1.0 (A:106-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkiivpnstagliigkggatvkaimeqsgawvqlsqkplqnrvvtvsgepeqnrkaveli
iqkiqedpq

SCOPe Domain Coordinates for d2anra2:

Click to download the PDB-style file with coordinates for d2anra2.
(The format of our PDB-style files is described here.)

Timeline for d2anra2: