| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255034] (1 PDB entry) |
| Domain d2amia_: 2ami A: [241235] automated match to d1npqa_ |
PDB Entry: 2ami (more details)
SCOPe Domain Sequences for d2amia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amia_ a.39.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rvglteeqkqeireafdlfdtdgsgtidakelkvamralgfepkkeeikkmiseidkdgs
gtidfeefltmmtakm
Timeline for d2amia_: