Lineage for d2amia_ (2ami A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711645Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255034] (1 PDB entry)
  8. 2711646Domain d2amia_: 2ami A: [241235]
    automated match to d1npqa_

Details for d2amia_

PDB Entry: 2ami (more details)

PDB Description: Solution Structure Of The Calcium-loaded N-Terminal Sensor Domain Of Centrin
PDB Compounds: (A:) Caltractin

SCOPe Domain Sequences for d2amia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amia_ a.39.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rvglteeqkqeireafdlfdtdgsgtidakelkvamralgfepkkeeikkmiseidkdgs
gtidfeefltmmtakm

SCOPe Domain Coordinates for d2amia_:

Click to download the PDB-style file with coordinates for d2amia_.
(The format of our PDB-style files is described here.)

Timeline for d2amia_: