![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.0: automated matches [254212] (1 protein) not a true family |
![]() | Protein automated matches [254478] (3 species) not a true protein |
![]() | Species Common lentil (Lens culinaris) [TaxId:3864] [255031] (1 PDB entry) |
![]() | Domain d2aiha_: 2aih A: [241234] automated match to d1bbia_ complexed with cl |
PDB Entry: 2aih (more details)
SCOPe Domain Sequences for d2aiha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aiha_ g.3.13.0 (A:) automated matches {Common lentil (Lens culinaris) [TaxId: 3864]} gddvksaccdtclctrsqpptcrcvdvreschsacdkcvcaysnppqcqcydthkfcyka chnseie
Timeline for d2aiha_: