SCOPe 2.07: Domain d2ahla1: 2ahl A:2-273

Lineage for d2ahla1 (2ahl A:2-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)

8. Domain d2ahla1: 2ahl A:2-273 [241232]
   Other proteins in same PDB: d2ahla2, d2ahlb_
   automated match to d2ahka_
   complexed with cu1, no3

Details for d2ahla1

PDB Entry: 2ahl, 1.6 Å

PDB Description: Crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d2ahla1:

Sequence; same for both SEQRES and ATOM records:

>d2ahla1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

Timeline for d2ahla1:

• d2ahla1 first appeared in SCOPe 2.04, called d2ahla_
  
• d2ahla1 appears in SCOPe 2.06
  
• d2ahla1 appears in the current release, SCOPe 2.08