Lineage for d2a73b8 (2a73 B:1496-1641)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398847Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2398882Family b.40.3.3: Netrin-like domain (NTR/C345C module) [89320] (3 proteins)
    Pfam PF01759
  6. 2398883Protein Complement C3 domain C345C [254374] (1 species)
  7. 2398884Species Human (Homo sapiens) [TaxId:9606] [254807] (1 PDB entry)
  8. 2398885Domain d2a73b8: 2a73 B:1496-1641 [241229]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7

Details for d2a73b8

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b8:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73b8 b.40.3.3 (B:1496-1641) Complement C3 domain C345C {Human (Homo sapiens) [TaxId: 9606]}
cfiqksddkvtleerldkacepgvdyvyktrlvkvqlsndfdeyimaieqtiksgsdevq
vgqqrtfispikcrealkleekkhylmwglssdfwgekpnlsyiigkdtwvehwpeedec
qdeenqkqcqdlgaftesmvvfgcpn

SCOPe Domain Coordinates for d2a73b8:

Click to download the PDB-style file with coordinates for d2a73b8.
(The format of our PDB-style files is described here.)

Timeline for d2a73b8: