Lineage for d2a73b7 (2a73 B:963-1268)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004699Family a.102.4.4: Complement components [48251] (4 protein domains)
    probably related to other families, but has no known enzymatic activity
  6. 2004703Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2004704Species Human (Homo sapiens) [TaxId:9606] [48253] (16 PDB entries)
  8. 2004733Domain d2a73b7: 2a73 B:963-1268 [241228]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b8

Details for d2a73b7

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: Human Complement Component C3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b7:

Sequence, based on SEQRES records: (download)

>d2a73b7 a.102.4.4 (B:963-1268) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
tpvaqmtedavdaerlkhlivtpsgcgeqnmigmtptviavhyldeteqwekfglekrqg
alelikkgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgav
kwlilekqkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvns
lpgsitkagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpg
kqlynveatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqk
dapdhq

Sequence, based on observed residues (ATOM records): (download)

>d2a73b7 a.102.4.4 (B:963-1268) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
tpvaqmtedavdaerlkhlivtpsgcgeqnmigmtptviavhyldeteqwekfglekrqg
alelikkgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgav
kwlilekqkpdgvfqedapvihqennnekdmaltafvlislqeakdiceeqvnslpgsit
kagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynv
eatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapdhq

SCOPe Domain Coordinates for d2a73b7:

Click to download the PDB-style file with coordinates for d2a73b7.
(The format of our PDB-style files is described here.)

Timeline for d2a73b7: